Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lumican/LUM, Human (HEK293, His)

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Lumican/LUM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lumican-lum-protein-human-hek-293-his.html

Purity

99.9

Smiles

QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Molecular Formula

4060 (Gene_ID) P51884 (Q19-N338) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG2a Isotype Control
AM08213RC7-N 100 µg

Rat IgG2a Isotype Control

Sign In for Pricing
View Details
Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [FITC]
NBP3-06377F 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [FITC]

Sign In for Pricing
View Details
Recombinant Human Thioredoxin-Like 1
32-5167-20 20 µg

Recombinant Human Thioredoxin-Like 1

Sign In for Pricing
View Details
Recombinant MAP kinase-activating death domain protein (aex-3), partial
MBS1025339 Inquire

Recombinant MAP kinase-activating death domain protein (aex-3), partial

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61012R-BF594-01 20 µL

Glucose 6 phosphate isomerase Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61012R-BF594-02 100 µL

Glucose 6 phosphate isomerase Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details