Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-6, Human

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.

Product Specifications

Product Name Alternative

GMP IL-6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-6-protein-human.html

Purity

98.0

Smiles

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (V30-M212) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MUM1 (D-11) Alexa Fluor® 546
sc-514332 AF546 200 µg/mL

MUM1 (D-11) Alexa Fluor® 546

Ask
View Details
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 550)
MBS6214133-01 0.1 mL

SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 550)

Ask
View Details
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 550)
MBS6214133-02 5x 0.1 mL

SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 550)

Ask
View Details
Glass Block, Rectangular, Superior
1110380/9 1 Each

Glass Block, Rectangular, Superior

Ask
View Details
Chl1 (NM_007697) Mouse Tagged Lenti ORF Clone
MR227423L4 10 µg

Chl1 (NM_007697) Mouse Tagged Lenti ORF Clone

Ask
View Details
Human Kallikrein 8 (KLK8) (NM_144505) AAV Particle
RC221010A1V 250 µL

Human Kallikrein 8 (KLK8) (NM_144505) AAV Particle

Ask
View Details