Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-6, Human

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.

Product Specifications

Product Name Alternative

GMP IL-6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-6-protein-human.html

Purity

98.0

Smiles

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (V30-M212) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Prss34 qPCR Primer Pair
QM71190S 200 Tests

Mouse Prss34 qPCR Primer Pair

Ask
View Details
Bovine G2/mitotic-specific cyclin-B1, CCNB1 ELISA KIT
ELI-48971b 96 Tests

Bovine G2/mitotic-specific cyclin-B1, CCNB1 ELISA KIT

Ask
View Details
SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)
MBS6351360-01 0.2 mL

SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)

Ask
View Details
SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)
MBS6351360-02 5x 0.2 mL

SSR4, ID (SSR4, TRAPD, Translocon-associated protein subunit delta, Signal sequence receptor subunit delta) (Azide free) (HRP)

Ask
View Details
CAPS Buffer 0.5M, pH 11.0
40320014-3 500 mL

CAPS Buffer 0.5M, pH 11.0

Ask
View Details