Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-6, Human

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.

Product Specifications

Product Name Alternative

GMP IL-6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-6-protein-human.html

Purity

98.0

Smiles

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (V30-M212) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat NR5A1 siRNA
abx926357-01 15 nmol

Rat NR5A1 siRNA

Ask
View Details
Rat NR5A1 siRNA
abx926357-02 30 nmol

Rat NR5A1 siRNA

Ask
View Details
CACNA1F (Calcium Channel, Voltage-Dependent, L Type, alpha 1F Subunit, AIED, COD3, CORDX, CORDX3, CSNB2, CSNB2A, CSNBX2, Cav1.4, JM8, JMC8, OA2) (HRP)
244138-HRP 100 µL

CACNA1F (Calcium Channel, Voltage-Dependent, L Type, alpha 1F Subunit, AIED, COD3, CORDX, CORDX3, CSNB2, CSNB2A, CSNBX2, Cav1.4, JM8, JMC8, OA2) (HRP)

Ask
View Details
RNF152 Protein Lysate (Rat) with C-HA Tag
40262036 100 µg

RNF152 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
PTPLB (HACD2) (NM_198402) Human Tagged ORF Clone Lentiviral Particle
RC208455L2V 200 µL

PTPLB (HACD2) (NM_198402) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
APC, ID (APC, DP2.5, Adenomatous polyposis coli protein, Deleted in polyposis 2.5) (FITC) discontinued
031955-FITC 200 µL

APC, ID (APC, DP2.5, Adenomatous polyposis coli protein, Deleted in polyposis 2.5) (FITC) discontinued

Ask
View Details