Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-6, Human

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.

Product Specifications

Product Name Alternative

GMP IL-6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-6-protein-human.html

Purity

98.0

Smiles

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (V30-M212) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fuz shRNA (UAS) - Lentiviral mouse Fuz shRNA (UAS, iRFP) plasmid
GTR15250180 1 Vial

Lentiviral mouse Fuz shRNA (UAS) - Lentiviral mouse Fuz shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rat Thymidine phosphorylase (TYMP) ELISA Kit
AE12651RA-01 48 Tests

Rat Thymidine phosphorylase (TYMP) ELISA Kit

Sign In for Pricing
View Details
Rat Thymidine phosphorylase (TYMP) ELISA Kit
AE12651RA-02 96 Tests

Rat Thymidine phosphorylase (TYMP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424617-01 0.12 mL

Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424617-02 0.2 mL

Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424617-03 5x 0.2 mL

Rabbit Anti Human RBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details