CXCL14/BRAK, Rat (N-His)
BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CXCL14/BRAK Protein, Rat (N-His), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cxcl14-brak-protein-rat-n-his.html
Purity
95.0
Smiles
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Molecular Formula
306748 (Gene_ID) Q8K453 (S23-E99) (Accession)
Molecular Weight
Approximately12 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Chang TM, et al. CXCL14 promotes metastasis of non-small cell lung cancer through ACKR2-depended signaling pathway. Int J Biol Sci. 2023 Feb 27;19 (5) :1455-1470.|[2]Du L, et al. Elevated CXCL14 in Induced Sputum Was Associated with Eosinophilic Inflammation and Airway Obstruction in Patients with Asthma. Int Arch Allergy Immunol. 2022;183 (11) :1216-1225.|[3]Kumar A, et al. CXCL14 Promotes a Robust Brain Tumor-Associated Immune Response in Glioma. Clin Cancer Res. 2022 Jul 1;28 (13) :2898-2910.|[4]Liu D, et al. Integrated analysis of 14 lymphoma datasets revealed high expression of CXCL14 promotes cell migration in mantle cell lymphoma. Aging (Albany NY) . 2022 Apr 22;14 (8) :3446-3463.|[5]Guo J, et al. Dysregulation of CXCL14 promotes malignant phenotypes of esophageal squamous carcinoma cells via regulating SRC and EGFR signaling. Biochem Biophys Res Commun. 2022 Jun 18;609:75-83.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-42083R-PE-Cy7 100 µL
DMBT1 Polyclonal Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 
