Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M protein (OSM), partial (Active)

Product Specifications

Product Name Alternative

OSM

Abbreviation

Recombinant Human OSM protein, partial (Active)

Gene Name

OSM

UniProt

P13725

Expression Region

26-234aa

Organism

Homo sapiens (Human)

Target Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity) .

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains), conjugated with TRITC Antibody
orb22095 1 mL

Goat Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains), conjugated with TRITC Antibody

Sign In for Pricing
View Details
NUDT1 Antibody
orb792960 2 mg

NUDT1 Antibody

Sign In for Pricing
View Details
GTF2IRD1 Rabbit pAb, AP conjugated
orb2864214 100 µL

GTF2IRD1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
NAA15 Peptide - middle region
MBS3244948-01 0.1 mg

NAA15 Peptide - middle region

Sign In for Pricing
View Details
NAA15 Peptide - middle region
MBS3244948-02 5x 0.1 mg

NAA15 Peptide - middle region

Sign In for Pricing
View Details
Goose Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit
MBS9924839 Inquire

Goose Ovalbumin Specific Immunoglobulin A (OVA-SIgA) ELISA Kit

Sign In for Pricing
View Details