Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-6, Mouse (HEK293, His)

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-6 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-6-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

Molecular Formula

16012 (Gene_ID) P47880 (A26-G238) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene C4 Br
HB08016001.100G 100 g

Polystyrene C4 Br

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS620873 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CCDC84 (N-term) Rabbit Polyclonal Antibody
AP50793PU-N 400 µL

CCDC84 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(4-Hydroxyphenyl)glycine
TRC-H949505-1G 1 g

(4-Hydroxyphenyl)glycine

Sign In for Pricing
View Details
Extra Shelf, stainless steel, for H2505-40
H2505-40SH 1 Each

Extra Shelf, stainless steel, for H2505-40

Sign In for Pricing
View Details
CHI3L1 Antibody
OC-273-01 50 μL

CHI3L1 Antibody

Sign In for Pricing
View Details