Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-6, Mouse (HEK293, His)

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-6 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-6-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

Molecular Formula

16012 (Gene_ID) P47880 (A26-G238) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL
BNCB0687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI10D10]
CF813799 100 µg

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI10D10]

Sign In for Pricing
View Details
3-Bromopropionyl Chloride
TRC-B678155-25G 25 g

3-Bromopropionyl Chloride

Sign In for Pricing
View Details
FKRP Human Gene Knockout Kit (CRISPR)
KN400941 1 Kit

FKRP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HAND1 Mouse Monoclonal Antibody [Clone ID: 8E7A11]
AM06262SU-N 100 µL

HAND1 Mouse Monoclonal Antibody [Clone ID: 8E7A11]

Sign In for Pricing
View Details
HypoGel® 400 TRT-OH
SP400110150120.25G 25 g

HypoGel® 400 TRT-OH

Sign In for Pricing
View Details