Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-6, Mouse (HEK293, His)

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-6 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-6-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

Molecular Formula

16012 (Gene_ID) P47880 (A26-G238) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-APP (Ponezumab)-MC-Vc-PAB-MMAE ADC
ADC-W-713 1 mg

Anti-APP (Ponezumab)-MC-Vc-PAB-MMAE ADC

Sign In for Pricing
View Details
Prostate Specific Antigen (Kallikrein 3, KLK3) BioAssayTM ELISA Kit (Rhesus monkey) discontinued
026331-01 48 Tests

Prostate Specific Antigen (Kallikrein 3, KLK3) BioAssayTM ELISA Kit (Rhesus monkey) discontinued

Sign In for Pricing
View Details
Prostate Specific Antigen (Kallikrein 3, KLK3) BioAssayTM ELISA Kit (Rhesus monkey) discontinued
026331-02 96 Tests

Prostate Specific Antigen (Kallikrein 3, KLK3) BioAssayTM ELISA Kit (Rhesus monkey) discontinued

Sign In for Pricing
View Details
GABARAPL2, CT (GATE16, GABA (A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein)
035844 200 µL

GABARAPL2, CT (GATE16, GABA (A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein)

Sign In for Pricing
View Details
PARVB
526725-01 100 µL

PARVB

Sign In for Pricing
View Details
PARVB
526725-02 200 µL

PARVB

Sign In for Pricing
View Details