Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIA, Human (N-His)

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (N-His) is the recombinant human-derived MIA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIA Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mia-protein-human-n-his.html

Purity

97.00

Smiles

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Molecular Formula

8190 (Gene_ID) Q16674 (G25-Q131) (Accession)

Molecular Weight

Approximately 14.0 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pump Tube Tygon® F-4040-A, 380mm, 3 tabs: grey-grey, PU=12 pieces
1214691 12 PCS/PCK

Pump Tube Tygon® F-4040-A, 380mm, 3 tabs: grey-grey, PU=12 pieces

Ask
View Details
Casd1 Mouse qPCR Primer Pair (NM_145398)
MP201765 200 Reactions

Casd1 Mouse qPCR Primer Pair (NM_145398)

Ask
View Details
Lentiviral mouse Enc1 shRNA (UAS) - Lentiviral mouse Enc1 shRNA (UAS) (25)
GTR15300560 1 Vial

Lentiviral mouse Enc1 shRNA (UAS) - Lentiviral mouse Enc1 shRNA (UAS) (25)

Ask
View Details
SNAP29 Protein Lysate (Rat) with C-HA Tag
44500036 100 µg

SNAP29 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
TMEM26 CRISPRa sgRNA lentivector (set of three targets)(Rat)
47033126 3x 1.0µg DNA

TMEM26 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details