MIA, Human (N-His)
MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (N-His) is the recombinant human-derived MIA protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIA Protein, Human (N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mia-protein-human-n-his.html
Purity
97.00
Smiles
GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Molecular Formula
8190 (Gene_ID) Q16674 (G25-Q131) (Accession)
Molecular Weight
Approximately 14.0 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A, TNFRSF1-A, CD120A, P55, TBP1, CD120-A, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60)