Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD209 antigen-like protein B (Cd209b), partial

Product Specifications

Product Name Alternative

DC-SIGN-related protein 1; DC-SIGNR1; OtB7; CD antigen CD209

Abbreviation

Recombinant Mouse Cd209b protein, partial

Gene Name

Cd209b

UniProt

Q8CJ91

Expression Region

74-325aa

Organism

Mus musculus (Mouse)

Target Sequence

QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Probable pathogen-recognition receptor. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. May recognize in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Beta-Site App-Cleaving Enzyme 1 ELISA Kit
MBS023216 Inquire

Cavy Beta-Site App-Cleaving Enzyme 1 ELISA Kit

Sign In for Pricing
View Details
IL25 AAV Vector (Rat) (CMV)
24870106 1 µg

IL25 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Lentiviral human ANKRD23 sgRNA gene knockout kit - Lentiviral human ANKRD23 sgRNA gene knockout kit (100)
GTR15359329 1 Vial

Lentiviral human ANKRD23 sgRNA gene knockout kit - Lentiviral human ANKRD23 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ValidElisa Kit
EK343256 96 Well

Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ValidElisa Kit

Sign In for Pricing
View Details
Monkey CKM (Creatine kinase M-type) ELISA Kit
EMK0178 96 Tests

Monkey CKM (Creatine kinase M-type) ELISA Kit

Sign In for Pricing
View Details
CRBN Polyclonal Antibody, Cy5.5 Conjugated
bs-25408R-Cy5.5 100 µL

CRBN Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details