Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG10, Human (GST)

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation[1].

Product Specifications

Product Name Alternative

ATG10 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atg10-protein-human-gst.html

Smiles

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Molecular Formula

83734 (Gene_ID) Q9H0Y0 (M1-P220) (Accession)

Molecular Weight

52.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM118A Human Gene Knockout Kit (CRISPR)
KN401902 1 Kit

FAM118A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELAC2 Human Gene Knockout Kit (CRISPR)
KN400764 1 Kit

ELAC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS627747 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
2-(Diethylamino)ethanethiol Hydrochloride
TRC-D679955-1G 1 g

2-(Diethylamino)ethanethiol Hydrochloride

Sign In for Pricing
View Details
Thbs3 Mouse Gene Knockout Kit (CRISPR)
KN517519 1 Kit

Thbs3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Linoleoyl-rac-glycerol-d5 O-TBS
TRC-L467966-5MG 5 mg

2-Linoleoyl-rac-glycerol-d5 O-TBS

Sign In for Pricing
View Details