Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG10, Human (GST)

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation[1].

Product Specifications

Product Name Alternative

ATG10 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atg10-protein-human-gst.html

Smiles

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Molecular Formula

83734 (Gene_ID) Q9H0Y0 (M1-P220) (Accession)

Molecular Weight

52.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC1A7 (NM_006671) Human Over-expression Lysate
LC401996 20 µg

SLC1A7 (NM_006671) Human Over-expression Lysate

Sign In for Pricing
View Details
MST3 Antibody (pThr184): ATTO 488
SPC-1032D-A488 100 µL

MST3 Antibody (pThr184): ATTO 488

Sign In for Pricing
View Details
TUT1 (NM_022830) Human Recombinant Protein
TP311126M 100 µg

TUT1 (NM_022830) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rat MMP-9 Protein (His Tag)
PKSR030381 50 µg

Recombinant Rat MMP-9 Protein (His Tag)

Sign In for Pricing
View Details
DKC1 Rabbit Polyclonal Antibody
AP06643PU-N 100 µg

DKC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRS1 pSer612 Rabbit Polyclonal Antibody
AP20954PU-N 100 µg

IRS1 pSer612 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details