Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP, Human (His, Fc)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA (A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

Product Specifications

Product Name Alternative

GABARAP Protein, Human (His, Fc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabarap-protein-human-his-fc.html

Purity

98.6

Smiles

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Molecular Formula

11337 (Gene_ID) Q6IAW1 (M1-L117) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details