Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP, Human (His, Fc)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA (A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

Product Specifications

Product Name Alternative

GABARAP Protein, Human (His, Fc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabarap-protein-human-his-fc.html

Purity

98.6

Smiles

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Molecular Formula

11337 (Gene_ID) Q6IAW1 (M1-L117) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPBP Antibody (N-term)
E45R05932G-1 100 µL

PPBP Antibody (N-term)

Sign In for Pricing
View Details
RAP1A CRISPRa sgRNA lentivector (set of three targets)(Human)
38494121 3x 1.0µg DNA

RAP1A CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
RGPD6 CytoSection
TS426429P5 25 Slides

RGPD6 CytoSection

Sign In for Pricing
View Details
POLB Antibody - C-terminal region
OASG02180-100UL 100 µL

POLB Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus tdk Protein (aa 1-199) (strain USA300)
VAng-Cr6473-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus tdk Protein (aa 1-199) (strain USA300)

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A H5N1 Hemagglutinin Antibody (1E7D8) [Alexa Fluor 405]
NBP1-75494AF405 0.1 mL

Mouse Monoclonal Influenza A H5N1 Hemagglutinin Antibody (1E7D8) [Alexa Fluor 405]

Sign In for Pricing
View Details