Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-7, Human (HEK293, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human (HEK293, His) is the recombinant human-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP IL-7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-7-protein-human-hek293-his.html

Purity

95.0

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

Molecular Weight

Approximately 19-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF740 conjugate, 0.1mg/mL
BNC741478-500 1x 500 µL

CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF647 conjugate, 0.1mg/mL
BNC470046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF640R conjugate, 0.1mg/mL
BNC401573-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF488A conjugate, 0.1mg/mL
BNC882818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details