Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 (IL9)

Product Specifications

Product Name Alternative

(IL-9) (Cytokine P40) (T-cell growth factor P40)

Abbreviation

Recombinant Human IL9 protein

Gene Name

IL9

UniProt

P15248

Expression Region

19-144aa

Organism

Homo sapiens (Human)

Target Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Multifunctional cytokine secreted mainly by T-helper 2 lymphocytes and also mast cells or NKT cells that plays important roles in the immune response against parasites. Affects intestinal epithelial permeability and adaptive immunity. In addition, induces the differentiation of specific T-cell subsets such as IL-17 producing helper T-cells (TH17) and also proliferation and differentiation of mast cells. Mechanistically, exerts its biological effects through a receptor composed of IL9R subunit and a signal transducing subunit IL2RG. Receptor stimulation results in the rapid activation of JAK1 and JAK3 kinase activities leading to STAT1, STAT3 and STAT5-mediated transcriptional programs. Induction of differentiation genes seems to be mediated by STAT1 alone, while protection of cells from apoptosis depends on STAT3 and STAT5.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

References & Citations

"Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease." Zee R.Y., Hoh J., Cheng S., Reynolds R., Grow M.A., Silbergleit A., Walker K., Steiner L., Zangenberg G., Fernandez-Ortiz A., Macaya C., Pintor E., Fernandez-Cruz A., Ott J., Lindpainter K. Pharmacogenomics J 2:197-201 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bis (2,4-dichlorophenyl) carbonate
MF-0037894-01 25 mg

Bis (2,4-dichlorophenyl) carbonate

Ask
View Details
Bis (2,4-dichlorophenyl) carbonate
MF-0037894-02 50 mg

Bis (2,4-dichlorophenyl) carbonate

Ask
View Details
Bis (2,4-dichlorophenyl) carbonate
MF-0037894-03 100 mg

Bis (2,4-dichlorophenyl) carbonate

Ask
View Details
TIMP1 Protein Lysate (Rat) with C-HA Tag
46729036 100 µg

TIMP1 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
250 mL, PET, Sterile, Double Bag Package, 30 pcs/pack, 4 packs/case, 120 pcs/case
352614 120 PCS/CS

250 mL, PET, Sterile, Double Bag Package, 30 pcs/pack, 4 packs/case, 120 pcs/case

Ask
View Details
VPS11 Antibody
A70751-50UL 50 μL

VPS11 Antibody

Ask
View Details