Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 (IL9)

Product Specifications

Product Name Alternative

(IL-9) (Cytokine P40) (T-cell growth factor P40)

Abbreviation

Recombinant Human IL9 protein

Gene Name

IL9

UniProt

P15248

Expression Region

19-144aa

Organism

Homo sapiens (Human)

Target Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Multifunctional cytokine secreted mainly by T-helper 2 lymphocytes and also mast cells or NKT cells that plays important roles in the immune response against parasites. Affects intestinal epithelial permeability and adaptive immunity. In addition, induces the differentiation of specific T-cell subsets such as IL-17 producing helper T-cells (TH17) and also proliferation and differentiation of mast cells. Mechanistically, exerts its biological effects through a receptor composed of IL9R subunit and a signal transducing subunit IL2RG. Receptor stimulation results in the rapid activation of JAK1 and JAK3 kinase activities leading to STAT1, STAT3 and STAT5-mediated transcriptional programs. Induction of differentiation genes seems to be mediated by STAT1 alone, while protection of cells from apoptosis depends on STAT3 and STAT5.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

References & Citations

"Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease." Zee R.Y., Hoh J., Cheng S., Reynolds R., Grow M.A., Silbergleit A., Walker K., Steiner L., Zangenberg G., Fernandez-Ortiz A., Macaya C., Pintor E., Fernandez-Cruz A., Ott J., Lindpainter K. Pharmacogenomics J 2:197-201 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromotubercidin
TRC-B702600-1MG 1 mg

5-Bromotubercidin

Sign In for Pricing
View Details
ST6GALNAC3 (NM_001160011) Human Over-expression Lysate
LY431170 100 µg

ST6GALNAC3 (NM_001160011) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Matk activation kit by CRISPRa
GA202581 1 Kit

Mouse Matk activation kit by CRISPRa

Sign In for Pricing
View Details
2-Chloro-7-hydroxy Phenothiazine
TRC-C366665-500MG 500 mg

2-Chloro-7-hydroxy Phenothiazine

Sign In for Pricing
View Details
CD80 Recombinant Mouse monoclonal Antibody
HA610122 100 µg

CD80 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF640R conjugate, 0.1mg/mL
BNC403803-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details