Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-5B (MUC5B), partial

Product Specifications

Product Name Alternative

MUC-5B; Cervical mucin; High molecular weight salivary mucin MG1; Mucin-5 subtype B, tracheobronchial; Sublingual gland mucin

Abbreviation

Recombinant Human MUC5B protein, partial

Gene Name

MUC5B

UniProt

Q9HC84

Expression Region

4186-4295aa

Organism

Homo sapiens (Human)

Target Sequence

ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF4V1 Human Gene Knockout Kit (CRISPR)
KN420116 1 Kit

PF4V1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CCL21 Antibody
RC-16222-01 50 μL

Recombinant CCL21 Antibody

Sign In for Pricing
View Details
Recombinant CCL21 Antibody
RC-16222-02 100 µL

Recombinant CCL21 Antibody

Sign In for Pricing
View Details
Recombinant CCL21 Antibody
RC-16222-03 1 mL

Recombinant CCL21 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -,  30nm
GP-2401-A-30 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -, 30nm

Sign In for Pricing
View Details
Ribociclib N-Hydroxy Metabolite (M13, Cci284)
TRC-R407550-5MG 5 mg

Ribociclib N-Hydroxy Metabolite (M13, Cci284)

Sign In for Pricing
View Details