B7-H2/ICOSLG, Human (HEK293, Fc)
B7-H2/ICOSLG Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal human IgG1 Fc fragment produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.
Product Specifications
Product Name Alternative
B7-H2/ICOSLG Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-fc.html
Purity
97.00
Smiles
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Molecular Formula
23308 (Gene_ID) O75144-1 (D19-S258) (Accession)
Molecular Weight
70-80 kDa
References & Citations
[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-500 1x 500 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880770-500 1x 500 µL
Cytokeratin 8/18 (C-43 + DC10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941461-100 1x 100 µL
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402044-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401731-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details