Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Product Specifications

Product Name Alternative

Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)

Abbreviation

Recombinant Human DLL3 protein, partial (Active)

Gene Name

DLL3

UniProt

Q9NYJ7

Expression Region

429-492aa

Organism

Homo sapiens (Human)

Target Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Developmental Biology

Relevance

Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU) . The EC50 is 3.990-4.723 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.1 kDa

References & Citations

Mutations in the MESP2 gene cause spondylothoracic dysostosis/Jarcho-Levin syndrome. Cornier A.S., Staehling-Hampton K., Delventhal K.M., Saga Y., Caubet J.-F., Sasaki N., Ellard S., Young E., Ramirez N., Pourquie O. Am. J. Hum. Genet. 82:1334-1341 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUNB pSer259 Rabbit Polyclonal Antibody
AP02328PU-N 100 µL

JUNB pSer259 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spata19 (BC049742) Mouse Tagged ORF Clone
MG200554 10 µg

Spata19 (BC049742) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(R,S)-Equol-d4 (Major) (Mixture of Diastereomers)
TRC-E593002-5MG 5 mg

(R,S)-Equol-d4 (Major) (Mixture of Diastereomers)

Sign In for Pricing
View Details
PSMC5 (NM_002805) Human Over-expression Lysate
LY419100 100 µg

PSMC5 (NM_002805) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706335 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
NMT2 Human Gene Knockout Kit (CRISPR)
KN402876 1 Kit

NMT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details