Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human.html

Purity

97.66

Smiles

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-1 (S78-I211) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schaar DG, et al. Multiple astrocyte transcripts encode nigral trophic factors in rat and human. Exp Neurol. 1994 Dec;130 (2) :387-93.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[4]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[5]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VPS36 Antibody, FITC conjugated
A60502-100UL 100 µL

VPS36 Antibody, FITC conjugated

Ask
View Details
Rat Gnptg Pre-designed siRNA Set A
SI205720A 1 Each

Rat Gnptg Pre-designed siRNA Set A

Ask
View Details
Porcine GFRα1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1) ValidElisa Kit
EK345553 96 Well

Porcine GFRα1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1) ValidElisa Kit

Ask
View Details
LONRF1 (h) -PR
sc-77587-PR 10 µM - 20 µL

LONRF1 (h) -PR

Ask
View Details
Mouse Monoclonal XTP4 Antibody (OTI2D5) [DyLight 755]
NBP2-74904IR 0.1 mL

Mouse Monoclonal XTP4 Antibody (OTI2D5) [DyLight 755]

Ask
View Details
SVOP, NT (SVOP, Synaptic vesicle 2-related protein) (MaxLight 405)
MBS6352747-01 0.1 mL

SVOP, NT (SVOP, Synaptic vesicle 2-related protein) (MaxLight 405)

Ask
View Details