Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human.html

Purity

97.66

Smiles

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-1 (S78-I211) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schaar DG, et al. Multiple astrocyte transcripts encode nigral trophic factors in rat and human. Exp Neurol. 1994 Dec;130 (2) :387-93.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[4]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[5]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella Multocida rpmA Protein (aa 1-85)
VAng-Cr7320-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida rpmA Protein (aa 1-85)

Sign In for Pricing
View Details
Pol Antibody
orb843469 2 mg

Pol Antibody

Sign In for Pricing
View Details
CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (APC)
172058-AF-APC 100 µL

CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (APC)

Sign In for Pricing
View Details
Mouse Anti-Human CD69 mAb (PerCP/Cy5.5)
orb2710333 100 Tests

Mouse Anti-Human CD69 mAb (PerCP/Cy5.5)

Sign In for Pricing
View Details
2-Fluoro-5-methyl-3- (methylthio) benzonitrile
PC1017199-01 250 mg

2-Fluoro-5-methyl-3- (methylthio) benzonitrile

Sign In for Pricing
View Details
2-Fluoro-5-methyl-3- (methylthio) benzonitrile
PC1017199-02 500 mg

2-Fluoro-5-methyl-3- (methylthio) benzonitrile

Sign In for Pricing
View Details