Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL11, Rhesus macaque (His)

The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CCL11 Protein, Rhesus macaque (His), Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl11-protein-rhesus-macaque-n-his.html

Purity

95.0

Smiles

GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP

Molecular Formula

574218 (Gene_ID) Q8MIT7 (G24-P97) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin peptide
orb374941 1 mg

Leptin peptide

Sign In for Pricing
View Details
RAB40B (Biotin)
574069-01 50 µg

RAB40B (Biotin)

Sign In for Pricing
View Details
RAB40B (Biotin)
574069-02 100 µg

RAB40B (Biotin)

Sign In for Pricing
View Details
Guinea Pig Cytochrome P450 26C1 (CYP26C1) ELISA Kit
GTR10359991 96 Well

Guinea Pig Cytochrome P450 26C1 (CYP26C1) ELISA Kit

Sign In for Pricing
View Details
Argininosuccinate Lyase (ASL) Antibody
abx377301-01 50 µg

Argininosuccinate Lyase (ASL) Antibody

Sign In for Pricing
View Details
Argininosuccinate Lyase (ASL) Antibody
abx377301-02 100 µg

Argininosuccinate Lyase (ASL) Antibody

Sign In for Pricing
View Details