Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APE, Human

APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases[1].

Product Specifications

Product Name Alternative

APE Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ape-protein-human.html

Purity

97.65

Smiles

PKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Molecular Formula

328 (Gene_ID) P27695 (P2-L318) (Accession)

Molecular Weight

Approximately 40.0 kDa

References & Citations

[1]Olga A Kladova, et al. The role of the N-terminal domain of human apurinic/apyrimidinic endonuclease 1, APE1, in DNA glycosylase stimulation.DNA Repair (Amst) . 2018 Apr;64:10-25

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf136 (NM_001109938) Human Over-expression Lysate
LY426309 100 µg

C6orf136 (NM_001109938) Human Over-expression Lysate

Sign In for Pricing
View Details
Vgll1 Mouse Gene Knockout Kit (CRISPR)
KN518884 1 Kit

Vgll1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Bfar activation kit by CRISPRa
GA207148 1 Kit

Mouse Bfar activation kit by CRISPRa

Sign In for Pricing
View Details
2,4-Diaminopyrimidine 3-N-Oxide Monohydrate
TRC-D415252-250MG 250 mg

2,4-Diaminopyrimidine 3-N-Oxide Monohydrate

Sign In for Pricing
View Details
Trim65 Mouse Gene Knockout Kit (CRISPR)
KN518233 1 Kit

Trim65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ricinine
TRC-R495550-1MG 1 mg

Ricinine

Sign In for Pricing
View Details