Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APE, Human

APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases[1].

Product Specifications

Product Name Alternative

APE Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ape-protein-human.html

Purity

97.65

Smiles

PKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Molecular Formula

328 (Gene_ID) P27695 (P2-L318) (Accession)

Molecular Weight

Approximately 40.0 kDa

References & Citations

[1]Olga A Kladova, et al. The role of the N-terminal domain of human apurinic/apyrimidinic endonuclease 1, APE1, in DNA glycosylase stimulation.DNA Repair (Amst) . 2018 Apr;64:10-25

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

prothymosin, alpha (PTMA) Mouse Monoclonal Antibody [Clone ID: 4G2]
AM32970PU-N 500 µg

prothymosin, alpha (PTMA) Mouse Monoclonal Antibody [Clone ID: 4G2]

Sign In for Pricing
View Details
GTF2IRD2B (NM_001003795) Human Over-expression Lysate
LY424010 100 µg

GTF2IRD2B (NM_001003795) Human Over-expression Lysate

Sign In for Pricing
View Details
Pure Pisum sativum Lectin (Garden Pea) -PEAPSA-
L-2701-10 10 mg

Pure Pisum sativum Lectin (Garden Pea) -PEAPSA-

Sign In for Pricing
View Details
TUBGCP4 Antibody
8C15872-AAT 50 µg

TUBGCP4 Antibody

Sign In for Pricing
View Details
Norbolethone
TRC-N661200-5MG 5 mg

Norbolethone

Sign In for Pricing
View Details
GR6 (LINC01565) Human Gene Knockout Kit (CRISPR)
KN424627 1 Kit

GR6 (LINC01565) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details