APE, Human
APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases[1].
Product Specifications
Product Name Alternative
APE Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ape-protein-human.html
Purity
97.65
Smiles
PKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Molecular Formula
328 (Gene_ID) P27695 (P2-L318) (Accession)
Molecular Weight
Approximately 40.0 kDa
References & Citations
[1]Olga A Kladova, et al. The role of the N-terminal domain of human apurinic/apyrimidinic endonuclease 1, APE1, in DNA glycosylase stimulation.DNA Repair (Amst) . 2018 Apr;64:10-25
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10321767 96 Well
Rat DNA Lyase Apurinic/Apyrimidinic Endonuclease 1 ELISA Kit
Sign In for Pricing
View Details MBS7018924-01 0.02 mg
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1)
Sign In for Pricing
View Details MBS7018924-02 0.1 mg
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1)
Sign In for Pricing
View Details 