Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Telomerase-binding protein EST1A (SMG6), partial

Product Specifications

Product Name Alternative

Ever shorter telomeres 1A; hEST1A; Nonsense mediated mRNA decay factor SMG6; Smg-6 homolog; hSmg5/7a

Abbreviation

Recombinant Human SMG6 protein, partial

Gene Name

SMG6

UniProt

Q86US8

Expression Region

1239-1419aa

Organism

Homo sapiens (Human)

Target Sequence

MELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. May have a general role in telomere regulation. Promotes in vitro the ability of TERT to elongate telomeres. Overexpression induces telomere uncapping, chromosomal end-to-end fusions (telomeric DNA persists at the fusion points) and did not perturb TRF2 telomeric localization. Binds to the single-stranded 5'- (GTGTGG) (4) GTGT-3' telomeric DNA, but not to a telomerase RNA template component (TER) . ; Plays a role in nonsense-mediated mRNA decay. Is thought to provide a link to the mRNA degradation machinery as it has endonuclease activity required to initiate NMD, and to serve as an adapter for UPF1 to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation. Degrades single-stranded RNA (ssRNA), but not ssDNA or dsRNA.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2J2 siRNA (Human)
CRJ4578-01 15 nmol

UBE2J2 siRNA (Human)

Sign In for Pricing
View Details
UBE2J2 siRNA (Human)
CRJ4578-02 30 nmol

UBE2J2 siRNA (Human)

Sign In for Pricing
View Details
Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit
MBS9318249-01 48 Well

Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit

Sign In for Pricing
View Details
Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit
MBS9318249-02 96 Well

Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit

Sign In for Pricing
View Details
Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit
MBS9318249-03 5x 96 Well

Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit

Sign In for Pricing
View Details
Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit
MBS9318249-04 10x 96 Well

Pig Acylamino-acid-releasing enzyme, APEH ELISA Kit

Sign In for Pricing
View Details