Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT6, Human (His)

STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat6-protein-human-his.html

Purity

95.00

Smiles

SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS

Molecular Formula

6778 (Gene_ID) P42226 (S627-S837) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adad2 Mouse Gene Knockout Kit (CRISPR)
KN500812 1 Kit

Adad2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ceacam20 Mouse Gene Knockout Kit (CRISPR)
KN503096 1 Kit

Ceacam20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAPPC2 (NM_001011658) Human Over-expression Lysate
LC423285 20 µg

TRAPPC2 (NM_001011658) Human Over-expression Lysate

Sign In for Pricing
View Details
Di-sec-butyl Phthalate
TRC-D429505-1G 1 g

Di-sec-butyl Phthalate

Sign In for Pricing
View Details
Skp1 Mouse Gene Knockout Kit (CRISPR)
KN515840 1 Kit

Skp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS635505 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details