Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT6, Human (His)

STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat6-protein-human-his.html

Purity

95.00

Smiles

SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS

Molecular Formula

6778 (Gene_ID) P42226 (S627-S837) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerol, 500ml
PC0908-500ml 500 mL

Glycerol, 500ml

Sign In for Pricing
View Details
2,2'-Diacetyldiphenyl Oxide
TRC-D754220-500MG 500 mg

2,2'-Diacetyldiphenyl Oxide

Sign In for Pricing
View Details
Elastase 3A (CELA3A) Rabbit Polyclonal Antibody
TA365763 100 µL

Elastase 3A (CELA3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UQCRHL Human Gene Knockout Kit (CRISPR)
KN419881 1 Kit

UQCRHL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human B9D1 activation kit by CRISPRa
GA108995 1 Kit

Human B9D1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), 0.2mg/mL
BNUB1042-100 1x 100 µL

TRIM29 (TRIM29/1042), 0.2mg/mL

Sign In for Pricing
View Details