Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT6, Human (His)

STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat6-protein-human-his.html

Purity

95.00

Smiles

SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS

Molecular Formula

6778 (Gene_ID) P42226 (S627-S837) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk2 Polyclonal Antibody
JOT-AP01628-01 20 µL

Cdk2 Polyclonal Antibody

Sign In for Pricing
View Details
Cdk2 Polyclonal Antibody
JOT-AP01628-02 50 μL

Cdk2 Polyclonal Antibody

Sign In for Pricing
View Details
Cdk2 Polyclonal Antibody
JOT-AP01628-03 100 µL

Cdk2 Polyclonal Antibody

Sign In for Pricing
View Details
RPS10P30 sgRNA CRISPR Lentivector (Human) (Target 1)
K2023302 1.0 µg DNA

RPS10P30 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-ATG4A (Ser100) Rabbit pAb
E47R5207 100 µL

Phospho-ATG4A (Ser100) Rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal BMP-2 Antibody (110) [Alexa Fluor 700]
NBP2-89490AF700 0.1 mL

Rabbit Monoclonal BMP-2 Antibody (110) [Alexa Fluor 700]

Sign In for Pricing
View Details