Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-7/LGALS7, Human (GST)

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Galectin-7/LGALS7 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-7-protein-human-gst.html

Smiles

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Molecular Formula

3963 (Gene_ID) P47929 (S2-F136) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Serine-2,3,3-d3
TRC-S270992-5MG 5 mg

L-Serine-2,3,3-d3

Sign In for Pricing
View Details
Bim (BCL2L11) Human qPCR Primer Pair (NM_138621)
HP226202 200 Reactions

Bim (BCL2L11) Human qPCR Primer Pair (NM_138621)

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL
BNC681530-500 1x 500 µL

Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFS1 Rabbit Polyclonal Antibody
TA379107 100 µL

NFS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCHIP1 (NM_001197107) Human Over-expression Lysate
LY434259 100 µg

SCHIP1 (NM_001197107) Human Over-expression Lysate

Sign In for Pricing
View Details
Usp11 Mouse Gene Knockout Kit (CRISPR)
KN518766 1 Kit

Usp11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details