Galectin-7/LGALS7, Human (GST)
Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
Galectin-7/LGALS7 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/galectin-7-protein-human-gst.html
Smiles
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Molecular Formula
3963 (Gene_ID) P47929 (S2-F136) (Accession)
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), 0.2mg/mL
