Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD3/C4.4A, Human (HEK293, His)

LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LYPD3/C4.4A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lypd3-c4-4a-protein-human-hek-293-his.html

Smiles

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH

Molecular Formula

27076 (Gene_ID) O95274 (L31-H286) (Accession)

Molecular Weight

Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL
BNC940957-500 1x 500 µL

Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF594 conjugate, 0.1mg/mL
BNC941968-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF488A conjugate, 0.1mg/mL
BNC882337-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL
BNC041828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL
BNC680666-500 1x 500 µL

Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details