Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF2, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFF2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tff2-protein-human-hek-293-his.html

Smiles

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Formula

7032 (Gene_ID) Q03403 (E24-Y129) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cwc22 shRNA (UAS) - Lentiviral mouse Cwc22 shRNA (UAS, iRFP) (100)
GTR15147003 1 Vial

Lentiviral mouse Cwc22 shRNA (UAS) - Lentiviral mouse Cwc22 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
DNA Replication Licensing Factor MCM2 (MCM2) Antibody
abx015924 100 µL

DNA Replication Licensing Factor MCM2 (MCM2) Antibody

Sign In for Pricing
View Details
Recombinant Shigella Sonnei ghrA Protein (aa 1-312)
VAng-Lsx09702-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei ghrA Protein (aa 1-312)

Sign In for Pricing
View Details
SPOCK1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2278003 1.0 µg DNA

SPOCK1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ELISA kit for Human Dihydrofolate reductase-like protein 1 (DHFRL1)
KTE62068-01 48 Tests

ELISA kit for Human Dihydrofolate reductase-like protein 1 (DHFRL1)

Sign In for Pricing
View Details
ELISA kit for Human Dihydrofolate reductase-like protein 1 (DHFRL1)
KTE62068-02 96 Tests

ELISA kit for Human Dihydrofolate reductase-like protein 1 (DHFRL1)

Sign In for Pricing
View Details