Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF2, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFF2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tff2-protein-human-hek-293-his.html

Smiles

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Formula

7032 (Gene_ID) Q03403 (E24-Y129) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC28A (Coiled-coil Domain Containing 28A, C6orf80, CCRL1AP, DKFZp586D0623, MGC131913) (FITC)
244285-FITC 100 µL

CCDC28A (Coiled-coil Domain Containing 28A, C6orf80, CCRL1AP, DKFZp586D0623, MGC131913) (FITC)

Sign In for Pricing
View Details
RM30 Antibody
C45940-01 50 μL

RM30 Antibody

Sign In for Pricing
View Details
RM30 Antibody
C45940-02 100 µL

RM30 Antibody

Sign In for Pricing
View Details
RN 1747
sc-296274A 50 mg

RN 1747

Sign In for Pricing
View Details
ATF1 Rabbit Polyclonal Antibody
TA367403 100 µL

ATF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human B7-1/CD80 Protein
RP02277 100 µg

Recombinant Human B7-1/CD80 Protein

Sign In for Pricing
View Details