Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF2, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFF2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tff2-protein-human-hek-293-his.html

Smiles

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Formula

7032 (Gene_ID) Q03403 (E24-Y129) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

DY 268 10mM * 1mL in DMSO
A16077-10mM-D 10 mM x 1mL in DMSO

DY 268 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Rabbit Polyclonal SERINC2 Antibody [Allophycocyanin]
NBP3-06100APC 0.1 mL

Rabbit Polyclonal SERINC2 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Fractalkine/CX3CL1, Canine (HEK293, His)
HY-P75779 1 Each

Fractalkine/CX3CL1, Canine (HEK293, His)

Sign In for Pricing
View Details
Recombinant Human M6PR Protein
E30P216 20 µg

Recombinant Human M6PR Protein

Sign In for Pricing
View Details
Mouse Monoclonal Carboxypeptidase A1/CPA1 Antibody (CPA1/2712) [Janelia Fluor 549]
NBP2-79880JF549 0.1 mL

Mouse Monoclonal Carboxypeptidase A1/CPA1 Antibody (CPA1/2712) [Janelia Fluor 549]

Sign In for Pricing
View Details
TUBGCP4 AAV Vector (Mouse) (CMV)
48833104 1 µg

TUBGCP4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details