Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF2, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFF2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tff2-protein-human-hek-293-his.html

Smiles

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Formula

7032 (Gene_ID) Q03403 (E24-Y129) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r187 3'UTR Luciferase Stable Cell Line
TU121850 1.0 mL

Vmn1r187 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse anti Mayaro Virus E2 (M990)
MAB12373-100 1 Each

Mouse anti Mayaro Virus E2 (M990)

Sign In for Pricing
View Details
RPS18P12 siRNA Oligos set (Human)
42188171 3x 5 nmol

RPS18P12 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ICAM2 (NM_001099788) Human Recombinant Protein
TP316706 20 µg

ICAM2 (NM_001099788) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse alpha Melanocyte Stimulating Hormone ELISA Kit
MBS043600-01 48 Well

Mouse alpha Melanocyte Stimulating Hormone ELISA Kit

Sign In for Pricing
View Details
Mouse alpha Melanocyte Stimulating Hormone ELISA Kit
MBS043600-02 96 Well

Mouse alpha Melanocyte Stimulating Hormone ELISA Kit

Sign In for Pricing
View Details