Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCL, Human (P.pastoris, His)

Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NCL Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ncl-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

Molecular Formula

4691 (Gene_ID) P19338 (V2-S482) (Accession)

Molecular Weight

Approximately 72 kDa. The reducing (R) protein migrat es as 72 kDa in SDS-PAGE may be due to post-translational modification.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CLLD6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9611R-BF594 100 µL

CLLD6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody
MBS438383-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody

Ask
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody
MBS438383-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody

Ask
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody
MBS438383-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody

Ask
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody
MBS438383-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody

Ask
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody
MBS438383-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Mouse Monoclonal Antibody

Ask
View Details