Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCL, Human (P.pastoris, His)

Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NCL Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ncl-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

Molecular Formula

4691 (Gene_ID) P19338 (V2-S482) (Accession)

Molecular Weight

Approximately 72 kDa. The reducing (R) protein migrat es as 72 kDa in SDS-PAGE may be due to post-translational modification.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody
CAU33274-01 100 µL

Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody

Ask
View Details
Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody
CAU33274-02 200 µL

Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody

Ask
View Details
Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody
CAU33274-03 1 mL

Melanoma Antigen Family B16 (MAGEB16) Polyclonal Antibody

Ask
View Details
PARP (214, 215) Cleavage Site (MaxLight 750) discontinued
P3113-03A-ML750 100 µL

PARP (214, 215) Cleavage Site (MaxLight 750) discontinued

Ask
View Details
Frozen Tissue Sections, Lung
CS622314 5x 5 µm

Frozen Tissue Sections, Lung

Ask
View Details
Recombinant Escherichia coli Uncharacterized 12.7 kDa protein in transposon Tn903
MBS1248415-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized 12.7 kDa protein in transposon Tn903

Ask
View Details