Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCL, Human (P.pastoris, His)

Nucleolar protein (NCL) is the major nucleolar protein in actively growing eukaryotic cells and is associated with intranucleolar chromatin and preribosomal granules. It induces chromatin decondensation by binding to histone H1 and plays a role in pre-rRNA transcription, ribosome assembly, and potential transcription elongation. NCL Protein, Human (P.pastoris, His) is the recombinant human-derived NCL protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NCL Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ncl-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

Molecular Formula

4691 (Gene_ID) P19338 (V2-S482) (Accession)

Molecular Weight

Approximately 72 kDa. The reducing (R) protein migrat es as 72 kDa in SDS-PAGE may be due to post-translational modification.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Myoz3 shRNA (UAS) - Lentiviral mouse Myoz3 shRNA (UAS, RFP) (25)
GTR15236051 1 Vial

Lentiviral mouse Myoz3 shRNA (UAS) - Lentiviral mouse Myoz3 shRNA (UAS, RFP) (25)

Ask
View Details
Human Janus Kinase 3 (JAK3) ELISA Kit
MBS456098-01 48 Tests

Human Janus Kinase 3 (JAK3) ELISA Kit

Ask
View Details
Human Janus Kinase 3 (JAK3) ELISA Kit
MBS456098-02 96 Tests

Human Janus Kinase 3 (JAK3) ELISA Kit

Ask
View Details
Human Janus Kinase 3 (JAK3) ELISA Kit
MBS456098-03 5x 96 Tests

Human Janus Kinase 3 (JAK3) ELISA Kit

Ask
View Details
Human Janus Kinase 3 (JAK3) ELISA Kit
MBS456098-04 10x 96 Tests

Human Janus Kinase 3 (JAK3) ELISA Kit

Ask
View Details
Recombinant Mouse FZD7 Protein, N-His-SUMO
YMB08201 100 μg

Recombinant Mouse FZD7 Protein, N-His-SUMO

Ask
View Details