Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2, Rat (HEK293, Fc)

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD2 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd2-protein-rat-hek293-fc.html

Purity

97.90

Smiles

RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLP

Molecular Formula

497761 (Gene_ID) Q5I0M6 (R23-P202) (Accession)

Molecular Weight

Approximately 57-75 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clic4 (NM_031818) Rat Untagged Clone
RN211465 10 µg

Clic4 (NM_031818) Rat Untagged Clone

Sign In for Pricing
View Details
RFX3 cDNA Clone
MBS1268261-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RFX3 cDNA Clone

Sign In for Pricing
View Details
RFX3 cDNA Clone
MBS1268261-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RFX3 cDNA Clone

Sign In for Pricing
View Details
Chicken High Sensitive ATP-Binding Cassette Sub-Family B Member 1 (ABCB1) ELISA Kit
MBS9344005 Inquire

Chicken High Sensitive ATP-Binding Cassette Sub-Family B Member 1 (ABCB1) ELISA Kit

Sign In for Pricing
View Details
CCL13 (C-C Motif Chemokine 13, CK-beta-10, Monocyte Chemoattractant Protein 4, Monocyte Chemotactic Protein 4, MCP-4, NCC-1, Small-inducible Cytokine A13, MCP4, NCC1, SCYA13, MGC17134) (MaxLight 405) discontinued
124441-ML405 100 µL

CCL13 (C-C Motif Chemokine 13, CK-beta-10, Monocyte Chemoattractant Protein 4, Monocyte Chemotactic Protein 4, MCP-4, NCC-1, Small-inducible Cytokine A13, MCP4, NCC1, SCYA13, MGC17134) (MaxLight 405) discontinued

Sign In for Pricing
View Details
WDR88 siRNA (Human)
orb1853412-01 15 nmol

WDR88 siRNA (Human)

Sign In for Pricing
View Details