Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Resistin (Retn)

Product Specifications

Product Name Alternative

Adipose tissue-specific secretory factor; Adipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3

Abbreviation

Recombinant Mouse Retn protein

Gene Name

Retn

UniProt

Q99P87

Expression Region

21-114aa

Organism

Mus musculus (Mouse)

Target Sequence

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008204-01 0.02 mg

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008204-02 0.1 mg

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
MBS7008204-03 5x 0.1 mg

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details
FBP2 Recombinant Protein (Rat)
RP200930 100 µg

FBP2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
8-Arm PEG-Mal (MW 5000)
HY-W1048605 1 Each

8-Arm PEG-Mal (MW 5000)

Sign In for Pricing
View Details
Anti-Human GPR39 Polyclonal Antibody
HC037014-01 50 µg

Anti-Human GPR39 Polyclonal Antibody

Sign In for Pricing
View Details