Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin (MYOC), partial

Product Specifications

Product Name Alternative

Myocilin 55 kDa subunit; Trabecular meshwork-induced glucocorticoid response protein

Abbreviation

Recombinant Human MYOC protein, partial

Gene Name

MYOC

UniProt

Q99972

Expression Region

241-504aa

Organism

Homo sapiens (Human)

Target Sequence

GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Secreted glycoprotein regulating the activation of different signaling pathways in adjacent cells to control different processes including cell adhesion, cell-matrix adhesion, cytoskeleton organization and cell migration. Promotes substrate adhesion, spreading and formation of focal contacts. Negatively regulates cell-matrix adhesion and stress fiber assembly through Rho protein signal transduction. Modulates the organization of actin cytoskeleton by stimulating the formation of stress fibers through interactions with components of Wnt signaling pathways. Promotes cell migration through activation of PTK2 and the downstream phosphatidylinositol 3-kinase signaling. Plays a role in bone formation and promotes osteoblast differentiation in a dose-dependent manner through mitogen-activated protein kinase signaling. Mediates myelination in the peripheral nervous system through ERBB2/ERBB3 signaling. Plays a role as a regulator of muscle hypertrophy through the components of dystrophin-associated protein complex. Involved in positive regulation of mitochondrial depolarization. Plays a role in neurite outgrowth. May participate in the obstruction of fluid outflow in the trabecular meshwork

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNDP2 Antibody - middle region
ARP57167_P050-25UL 25 µL

CNDP2 Antibody - middle region

Sign In for Pricing
View Details
anti-DMRT2
YF-PA25634 50 ul

anti-DMRT2

Sign In for Pricing
View Details
Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)
TMPH-00049-01 5 µg

Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)

Sign In for Pricing
View Details
Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)
TMPH-00049-02 10 µg

Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)

Sign In for Pricing
View Details
Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)
TMPH-00049-03 20 µg

Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)

Sign In for Pricing
View Details
Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)
TMPH-00049-04 50 µg

Pectate lyase 5 Protein, Ambrosia artemisiifolia, Recombinant (His)

Sign In for Pricing
View Details