Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 106A (TMEM106A), partial

Product Specifications

Product Name Alternative

TMEM106A

Abbreviation

Recombinant Human TMEM106A protein, partial

Gene Name

TMEM106A

UniProt

Q96A25

Expression Region

1-94aa

Organism

Homo sapiens (Human)

Target Sequence

MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKL

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway. Upon activation, up-regulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide. May play a role in inhibition of proliferation and migration

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/992), CF640R conjugate, 0.1mg/mL
BNC400992-100 1x 100 µL

SOX10 (SOX10/992), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF405S conjugate, 0.1mg/mL
BNC042152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL
BNC041924-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details