Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Ara h 8 allergen

Product Specifications

Abbreviation

Recombinant Arachis hypogaea Ara h 8 allergen protein

UniProt

Q6VT83

Expression Region

1-157aa

Organism

Arachis hypogaea (Peanut)

Target Sequence

MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Ras Homolog Gene Family, Member A ELISA Kit
MBS076713 Inquire

Cavy Ras Homolog Gene Family, Member A ELISA Kit

Sign In for Pricing
View Details
Phospho-NPM (Thr199) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3310R-BF750 100 µL

Phospho-NPM (Thr199) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Ilaprazole Impurity 41
RM-I120141-01 10 mg

Ilaprazole Impurity 41

Sign In for Pricing
View Details
Ilaprazole Impurity 41
RM-I120141-02 25 mg

Ilaprazole Impurity 41

Sign In for Pricing
View Details
Ilaprazole Impurity 41
RM-I120141-03 50 mg

Ilaprazole Impurity 41

Sign In for Pricing
View Details
Ilaprazole Impurity 41
RM-I120141-04 100 mg

Ilaprazole Impurity 41

Sign In for Pricing
View Details