Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial

Product Specifications

Product Name Alternative

Outer mitochondrial membrane protein porin 2; Voltage-dependent anion-selective channel protein 6

Abbreviation

Recombinant Mouse Vdac2 protein, partial

Gene Name

Vdac2

UniProt

Q60930

Expression Region

1-37aa

Organism

Mus musculus (Mouse)

Target Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFG

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane. The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials. There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state. Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol. Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apocynin
TRC-A727200-5G 5 g

Apocynin

Sign In for Pricing
View Details
Cep19 (NM_025892) Mouse Tagged ORF Clone
MG201297 10 µg

Cep19 (NM_025892) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AH 7921 Hydrochloride
TRC-A434500-5MG 5 mg

AH 7921 Hydrochloride

Sign In for Pricing
View Details
LEMD1 Human Gene Knockout Kit (CRISPR)
KN422864 1 Kit

LEMD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCN4A (NM_000334) Human Over-expression Lysate
LC424791 20 µg

SCN4A (NM_000334) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF577 Human Gene Knockout Kit (CRISPR)
KN401369 1 Kit

ZNF577 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details