Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-1 beta (IL1B)

Product Specifications

Product Name Alternative

IL-1 beta; IL1B

Abbreviation

Recombinant Macaca fascicularis IL1B protein

Gene Name

IL1B

UniProt

P79182

Expression Region

117-268aa

Organism

Macaca fascicularis (Crab-eating macaque)

Target Sequence

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAESMPVFLGGTRGGQDITDFTMQFVS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62460R-BF555-TR 20 µL

Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit
MBS7618062-01 48 Well

Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit

Sign In for Pricing
View Details
Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit
MBS7618062-02 96 Well

Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit

Sign In for Pricing
View Details
Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit
MBS7618062-03 5x 96 Well

Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit

Sign In for Pricing
View Details
Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit
MBS7618062-04 10x 96 Well

Monkey ApoB100 (Apolipoprotein B100) high sensitivity ELISA Kit

Sign In for Pricing
View Details
RAB10 cDNA Clone
MBS1265828-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RAB10 cDNA Clone

Sign In for Pricing
View Details