Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pituitary homeobox 1 (PITX1)

Product Specifications

Product Name Alternative

Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1

Abbreviation

Recombinant Human PITX1 protein

Gene Name

PITX1

UniProt

P78337

Expression Region

1-314aa

Organism

Homo sapiens (Human)

Target Sequence

MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-6828-5p miRNA Antagomir
MBS8318261-01 10 nmol

hsa-miR-6828-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6828-5p miRNA Antagomir
MBS8318261-02 20 nmol

hsa-miR-6828-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6828-5p miRNA Antagomir
MBS8318261-03 5x 20 nmol

hsa-miR-6828-5p miRNA Antagomir

Sign In for Pricing
View Details
TECTA Rabbit Polyclonal Antibody (APC)
orb2616145 100 µg

TECTA Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
FNBP3 Lentiviral Activation Particles (h2)
sc-412568-LAC-2 200 µL

FNBP3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
GOLGA6L10 siRNA (Human)
orb1849719-01 15 nmol

GOLGA6L10 siRNA (Human)

Sign In for Pricing
View Details