Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pituitary homeobox 1 (PITX1)

Product Specifications

Product Name Alternative

Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1

Abbreviation

Recombinant Human PITX1 protein

Gene Name

PITX1

UniProt

P78337

Expression Region

1-314aa

Organism

Homo sapiens (Human)

Target Sequence

MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexyl Acetoacetate
OR1077694 25 mL

Hexyl Acetoacetate

Sign In for Pricing
View Details
Human A Disintegrin And Metalloprotease 28 (ADAM28) ELISA Kit
EK12434 48 Tests

Human A Disintegrin And Metalloprotease 28 (ADAM28) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human THOC5 shRNA (UAS) - Lentiviral human THOC5 shRNA (UAS, iRFP) (100)
GTR15147015 1 Vial

Lentiviral human THOC5 shRNA (UAS) - Lentiviral human THOC5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Nesprin 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-19207R-BF594 100 µL

Nesprin 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Na(+)-translocating NADH-quinone reductase subunit E
MBS7023583-01 0.02 mg

Recombinant Haemophilus influenzae Na(+)-translocating NADH-quinone reductase subunit E

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Na(+)-translocating NADH-quinone reductase subunit E
MBS7023583-02 0.1 mg

Recombinant Haemophilus influenzae Na(+)-translocating NADH-quinone reductase subunit E

Sign In for Pricing
View Details