Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pituitary homeobox 1 (Pitx1)

Product Specifications

Product Name Alternative

Hindlimb-expressed homeobox protein backfoot; Homeobox protein P-OTX; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1; Pituitary OTX-related factor

Abbreviation

Recombinant Mouse Pitx1 protein

Gene Name

Pitx1

UniProt

P70314

Expression Region

1-315aa

Organism

Mus musculus (Mouse)

Target Sequence

MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Can independently activate and synergize with PIT-1 on pituitary-specific target gene promoters, thus may subserve functions in generating both precursor and specific cell phenotypes in the anterior pituitary gland and in several other organs. Can activate pituitary transcription of the proopiomelanocortin gene

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3’-Deoxy Uridine
TRC-D288000-25MG 25 mg

3’-Deoxy Uridine

Sign In for Pricing
View Details
VC pBR 322/ Hae III Marker (ready-to-use), 5 x 50µg
NM2432 5 x 50μg

VC pBR 322/ Hae III Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
Adam24 Mouse Gene Knockout Kit (CRISPR)
KN500828 1 Kit

Adam24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RHBDL1 Human Gene Knockout Kit (CRISPR)
KN421768 1 Kit

RHBDL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phenyl Chloroformate
TRC-P319880-50G 50 g

Phenyl Chloroformate

Sign In for Pricing
View Details
(3R,4S)-3-Hydroxy-4-phenyl-2-azetidinone
TRC-H949085-250MG 250 mg

(3R,4S)-3-Hydroxy-4-phenyl-2-azetidinone

Sign In for Pricing
View Details