Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

Product Specifications

Product Name Alternative

Vacuolar proton pump subunit C 1

Abbreviation

Recombinant Human ATP6V1C1 protein

Gene Name

ATP6V1C1

UniProt

P21283

Expression Region

2-382aa

Organism

Homo sapiens (Human)

Target Sequence

TEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Subunit of the V1 complex of vacuolar (H+) -ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 650)
MBS6246398-01 0.1 mL

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 650)

Ask
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 650)
MBS6246398-02 5x 0.1 mL

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 650)

Ask
View Details
CLIP3 Antibody
A12580-100UG 100 µg

CLIP3 Antibody

Ask
View Details