Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tumor necrosis factor (Tnf), partial (Active)

Product Specifications

Product Name Alternative

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a) ; Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF) ; Intracellular domain 1 (ICD1) ; Intracellular domain 2 (ICD2) ; C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

Abbreviation

Recombinant Rat Tnf protein, partial (Active)

Gene Name

Tnf

UniProt

P16599

Expression Region

80-235aa

Organism

Rattus norvegicus (Rat)

Target Sequence

LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6. Promotes osteoclastogenesis and therefore mediates bone resorption. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 18.58-33.99 pg/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

CHIP attenuates lipopolysaccharide-induced cardiac hypertrophy and apoptosis by promoting NFATc3 proteasomal degradation. Chao C.N., Lai C.H., Badrealam K.F., Lo J.F., Shen C.Y., Chen C.H., Chen R.J., Viswanadha V.P., Kuo W.W., Huang C.Y. J. Cell. Physiol. 234:20128-20138 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrin 3 (MATR3) (NM_199189) Human Over-expression Lysate
LS009782 100 µg

Matrin 3 (MATR3) (NM_199189) Human Over-expression Lysate

Sign In for Pricing
View Details
CXorf30 Antibody - C-terminal region (ARP70084_P050)
ARP70084_P050 100 µL

CXorf30 Antibody - C-terminal region (ARP70084_P050)

Sign In for Pricing
View Details
FAM90A15P AAV Vector (Human) (CMV)
20185101 1 µg

FAM90A15P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
C1orf201 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14182111 3x 1.0 µg

C1orf201 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Dog Interleukin 3
RPU61253-01 50 µg

Dog Interleukin 3

Sign In for Pricing
View Details
Dog Interleukin 3
RPU61253-02 100 µg

Dog Interleukin 3

Sign In for Pricing
View Details