Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 (CXCL8), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1 (GCP-1) ; Monocyte-derived neutrophil chemotactic factor (MDNCF) ; CXCL8; IL8

Abbreviation

Recombinant Human CXCL8 protein, partial (Active)

Gene Name

CXCL8

UniProt

P10145

Expression Region

28-99aa

Organism

Homo sapiens (Human)

Target Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells. G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/mL can bind Anti-CXCL8 recombinant antibody (CSB-RA011671MA1HU) . The EC50 is 43.95-46.76 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.4 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW12 Antibody
E306581 100 µg - 200 µL

FBXW12 Antibody

Sign In for Pricing
View Details
alpha Internexin (INA) Human qPCR Primer Pair (NM_032727)
HP216122 200 Reactions

alpha Internexin (INA) Human qPCR Primer Pair (NM_032727)

Sign In for Pricing
View Details
Rabbit Polyclonal PECI Antibody
NBP2-48614 0.1 mL

Rabbit Polyclonal PECI Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Th-POK Antibody (PCRP-ZBTB7B-1B6) [DyLight 650]
NBP3-08311C 100 µL

Mouse Monoclonal Th-POK Antibody (PCRP-ZBTB7B-1B6) [DyLight 650]

Sign In for Pricing
View Details
NOV, Human
1150-01B9-5-5μg 5 μg

NOV, Human

Sign In for Pricing
View Details
Mouse S100a9 qPCR Primer Pair
QM20570S 200 Tests

Mouse S100a9 qPCR Primer Pair

Sign In for Pricing
View Details