Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

Abbreviation

Recombinant Human F9 protein, partial

Gene Name

F9

UniProt

P00740

Expression Region

93-129aa

Organism

Homo sapiens (Human)

Target Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca (2+) ions, phospholipids, and factor VIIIa

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hemopexin (HPX, HX, Beta-1B-glycoprotein, FLJ56652, Hemo) (Azide free) (HRP)
H1865-05B-HRP 200 µL

Hemopexin (HPX, HX, Beta-1B-glycoprotein, FLJ56652, Hemo) (Azide free) (HRP)

Sign In for Pricing
View Details
FBXO8 cDNA Clone
MBS1272783-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

FBXO8 cDNA Clone

Sign In for Pricing
View Details
FBXO8 cDNA Clone
MBS1272783-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

FBXO8 cDNA Clone

Sign In for Pricing
View Details
Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit
MBS1604239-01 48 Well

Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit

Sign In for Pricing
View Details
Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit
MBS1604239-02 96 Well

Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit

Sign In for Pricing
View Details
Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit
MBS1604239-03 5x 96 Well

Goat Ubiquitin-related modifier 1 homolog, URM1 ELISA Kit

Sign In for Pricing
View Details